Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEAR1 Polyclonal Antibody
ABP59874-01 30 µL

PEAR1 Polyclonal Antibody

Sign In for Pricing
View Details
PEAR1 Polyclonal Antibody
ABP59874-02 100 µL

PEAR1 Polyclonal Antibody

Sign In for Pricing
View Details
PEAR1 Polyclonal Antibody
ABP59874-03 200 µL

PEAR1 Polyclonal Antibody

Sign In for Pricing
View Details
Human HIF-1 alpha Recombinant Protein
PROTQ16665-10ug 10 µg

Human HIF-1 alpha Recombinant Protein

Sign In for Pricing
View Details
IQGAP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1096908 1.0 µg DNA

IQGAP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Murine RNase inhibitor (200 U/μL, Glycerol-free)
10703ES05 2 KU

Murine RNase inhibitor (200 U/μL, Glycerol-free)

Sign In for Pricing
View Details