Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-01 0.02 mg (E-Coli)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-02 0.02 mg (Yeast)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-03 0.1 mg (E-Coli)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-04 0.1 mg (Yeast)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-05 0.02 mg (Baculovirus)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger protein 770 (Znf770)
MBS1396741-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Zinc finger protein 770 (Znf770)

Sign In for Pricing
View Details