Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC046404 Protein Vector (Mouse) (pPM-C-HA)
PV158684 500 ng

BC046404 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
C1r LC Rabbit Polyclonal Antibody
E53P02115 100 µL

C1r LC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAAR1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2325003 1.0 µg DNA

TAAR1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal Alkaline Phosphatase/ALPP Antibody (ALPP/2899R) [DyLight 594]
NBP3-08817DL594 100 µL

Rabbit Monoclonal Alkaline Phosphatase/ALPP Antibody (ALPP/2899R) [DyLight 594]

Sign In for Pricing
View Details
SPATS2 (Spermatogenesis-Associated Serine-rich Protein 2, Serine-rich spermatocytes and round spermatid 59kD Protein, p59scr, SPATS2, SCR59, SPATA10) (MaxLight 550) discontinued
302766-ML550 100 µL

SPATS2 (Spermatogenesis-Associated Serine-rich Protein 2, Serine-rich spermatocytes and round spermatid 59kD Protein, p59scr, SPATS2, SCR59, SPATA10) (MaxLight 550) discontinued

Sign In for Pricing
View Details
STK35 (NM_080836) Human Over-expression Lysate
LH00700V 100 µg

STK35 (NM_080836) Human Over-expression Lysate

Sign In for Pricing
View Details