Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHB2 3'UTR Luciferase Stable Cell Line
TU017505 1.0 mL

PCDHB2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human POC5 Pre-designed siRNA Set B
SI012477B 1 Each

Human POC5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Acrp30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (MaxLight 650) discontinued
A0891-01B-ML650 100 µL

Acrp30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ANKRD62P1 Protein Vector (Human) (pPB-His-GST)
PV322219 500 ng

ANKRD62P1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Diagnostic Kit for 25-HydroxyvitaminD
07OHVD5025 25 Tests

Diagnostic Kit for 25-HydroxyvitaminD

Sign In for Pricing
View Details
Recombinant Borrelia garinii Probable transcriptional regulatory protein BG0025 (BG0025)
MBS1400461-01 0.02 mg (E-Coli)

Recombinant Borrelia garinii Probable transcriptional regulatory protein BG0025 (BG0025)

Sign In for Pricing
View Details