Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alkaline Phosphatase/ALPI, Rat (HEK293, His)

The ALPI protein, an alkaline phosphatase enzyme, hydrolyzes phosphate compounds, demonstrating enzymatic activity in breaking down different phosphate molecules. Alkaline Phosphatase/ALPI Protein, Rat (HEK293, His) is the recombinant rat-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

Alkaline Phosphatase/ALPI Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpi-protein-rat-hek293-his.html

Purity

95.0

Smiles

VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN

Molecular Formula

24197 (Gene_ID) P15693 (V21-N511) (Accession)

Molecular Weight

Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIAO1 (NM_004804) Human Over-expression Lysate
LS009391-100ug 100 µg

CIAO1 (NM_004804) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-TPT1
orb1133361 100 µL

Anti-TPT1

Sign In for Pricing
View Details
Simport Embedding Lid White
HIS0164-01 2000 / PCK

Simport Embedding Lid White

Sign In for Pricing
View Details
Simport Embedding Lid White
HIS0164-02 2000 / PCK

Simport Embedding Lid White

Sign In for Pricing
View Details
Recombinant Free Fatty Acid Receptor 3 (FFAR3)
TRV-0014267-01 10 µg

Recombinant Free Fatty Acid Receptor 3 (FFAR3)

Sign In for Pricing
View Details
Recombinant Free Fatty Acid Receptor 3 (FFAR3)
TRV-0014267-02 50 µg

Recombinant Free Fatty Acid Receptor 3 (FFAR3)

Sign In for Pricing
View Details