What is the catalog number for IFN-lambda 1/IL-29, Human?

The catalog number for IFN-lambda 1/IL-29, Human is HY-P7026.

What sizes are available for IFN-lambda 1/IL-29, Human?

IFN-lambda 1/IL-29, Human is available in the following size(s): 10 µg, 50 µg, 100 µg.

How many pack sizes does IFN-lambda 1/IL-29, Human come in?

IFN-lambda 1/IL-29, Human is available in 3 different pack sizes.

Is IFN-lambda 1/IL-29, Human in stock?

IFN-lambda 1/IL-29, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures IFN-lambda 1/IL-29, Human?

IFN-lambda 1/IL-29, Human is manufactured by QuantiMol.

What is the estimated delivery time for IFN-lambda 1/IL-29, Human?

Estimated delivery time for IFN-lambda 1/IL-29, Human is approximately 15 business day(s), depending on your location.

IFN-lambda 1/IL-29, Human

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB) . When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2]. IFN-lambda 1/IL-29 Protein, Human is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in E. coli.

Product Specifications

Product Name Alternative

IFN-lambda 1/IL-29 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-lambda1-il-29-protein-human.html

Purity

97.0

Smiles

GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Molecular Formula

282618 (Gene_ID) Q8IU54 (G20-T200) (Accession)

Molecular Weight

Approximately 19.8 kDa

References & Citations

[1]Dantas AT, et al. Interferons and systemic sclerosis: correlation between interferon gamma and interferon-lambda 1 (IL-29) . Autoimmunity. 2015;48 (7) :429-33.|[2]Srinivas S, et al. Interferon-lambda1 (interleukin-29) preferentially down-regulates interleukin-13 over other T helper type 2 cytokine responses in vitro. Immunology. 2008 Dec;125 (4) :492-502.|[3]Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30 (8) :555-64.|[4]Wu Q, et al. Serum IFN-λ1 is abnormally elevated in rheumatoid arthritis patients. Autoimmunity. 2013 Feb;46 (1) :40-3.|[5]Kelm NE, et al. The role of IL-29 in immunity and cancer. Crit Rev Oncol Hematol. 2016 Oct;106:91-8.|[6]Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57 (2) :171-9.|[7]Xu L, et al. Interleukin-29 Enhances Synovial Inflammation and Cartilage Degradation in Osteoarthritis. Mediators Inflamm. 2016;2016:9631510.|[8]Yu Y, et al. Hepatitis B virus induces a novel inflammation network involving three inflammatory factors, IL-29, IL-8, and cyclooxygenase-2. J Immunol. 2011 Nov 1;187 (9) :4844-60.