Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Interleukin-8 protein (CXCL8) (Active)

Product Specifications

Product Name Alternative

IL-8, Chemokine C-X-C motif, ligand 8

Abbreviation

Recombinant Rhesus macaque CXCL8 protein (Active)

Gene Name

CXCL8

UniProt

P67813

Expression Region

23-101aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.5-5.0 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus (By similarity) .

Molecular Weight

9.14 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Death-associated protein 1 Polyclonal Antibody
orb359528 100 µg

Death-associated protein 1 Polyclonal Antibody

Sign In for Pricing
View Details
ASCL1 (74-173) goat polyclonal antibody
GT15216-100 100 µg

ASCL1 (74-173) goat polyclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Dync1li2 shRNA (UAS) - Lentiviral mouse Dync1li2 shRNA (UAS, GFP) plasmid
GTR15199306 1 Vial

Lentiviral mouse Dync1li2 shRNA (UAS) - Lentiviral mouse Dync1li2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit
MBS081203-01 48 Well

Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit
MBS081203-02 96 Well

Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit
MBS081203-03 5x 96 Well

Human Nuclear Mitotic Apparatus Protein 1 ELISA Kit

Sign In for Pricing
View Details