Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYBB/Nox2, Human (His)

The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CYBB/Nox2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cybb-nox2-protein-human-his.html

Purity

95.00

Smiles

ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Molecular Formula

1536 (Gene_ID) P04839 (E283-F570) (Accession)

Molecular Weight

Approximately 34-37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin β C Chain; INHBC Protein (N-His, Human)
P516359 100 µg

Inhibin β C Chain; INHBC Protein (N-His, Human)

Sign In for Pricing
View Details
perk (Phospho-Ser555) Polyclonal Conjugated Antibody
C12887 100 µL

perk (Phospho-Ser555) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Dkk2 (NM_001106472) Rat Untagged Clone
RN202964 10 µg

Dkk2 (NM_001106472) Rat Untagged Clone

Sign In for Pricing
View Details
KatG Antibody
orb819847 2 mg

KatG Antibody

Sign In for Pricing
View Details
EIF1AY discontinued
343104-01 100 µL

EIF1AY discontinued

Sign In for Pricing
View Details
EIF1AY discontinued
343104-02 200 µL

EIF1AY discontinued

Sign In for Pricing
View Details