Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIBP, Human

FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FIBP Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fibp-protein-human.html

Smiles

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Molecular Formula

9158 (Gene_ID) O43427-2/NP_004205.2 (M1-D357) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glo1 (NM_025374) Mouse Tagged Lenti ORF Clone
MR201690L3 10 µg

Glo1 (NM_025374) Mouse Tagged Lenti ORF Clone

Ask
View Details
Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit
MBS7202127-01 48 Well

Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit

Ask
View Details
Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit
MBS7202127-02 96 Well

Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit

Ask
View Details
Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit
MBS7202127-03 5x 96 Well

Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit

Ask
View Details
Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit
MBS7202127-04 10x 96 Well

Porcine 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2 (PFKFB2) ELISA Kit

Ask
View Details
Recombinant Clostridium botulinum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1104843-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details