Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. IL-22 Protein, Human (His) is the recombinant human-derived IL-22 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-human-his.html

Purity

96.0

Smiles

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR33 Polyclonal Antibody
MBS2562790-01 0.02 mL

WDR33 Polyclonal Antibody

Sign In for Pricing
View Details
WDR33 Polyclonal Antibody
MBS2562790-02 0.06 mL

WDR33 Polyclonal Antibody

Sign In for Pricing
View Details
WDR33 Polyclonal Antibody
MBS2562790-03 0.12 mL

WDR33 Polyclonal Antibody

Sign In for Pricing
View Details
WDR33 Polyclonal Antibody
MBS2562790-04 0.2 mL

WDR33 Polyclonal Antibody

Sign In for Pricing
View Details
WDR33 Polyclonal Antibody
MBS2562790-05 5x 0.2 mL

WDR33 Polyclonal Antibody

Sign In for Pricing
View Details
SFRP1 Recombinant Rabbit mAb
orb2326328-01 25 µL

SFRP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details