Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Mouse (HEK293, hFc-His)

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes.This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications.Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding.L-selectin/CD62L Protein, Mouse (HEK293, hFc-His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-6*His, C-Fc labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Mouse (HEK293, hFc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-mouse-hek-293-his.html

Purity

97.00

Smiles

WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

Molecular Formula

20343 (Gene_ID) P18337 (W39-N332) (Accession)

Molecular Weight

90-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF4 (NM_004235) Human Tagged ORF Clone Lentiviral Particle
RC206691L4V 200 µL

KLF4 (NM_004235) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PSMD11 sgRNA CRISPR Lentivector (Human) (Target 1)
K1743502 1.0 µg DNA

PSMD11 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RN-tre Antibody
C19466-01 50 μL

RN-tre Antibody

Sign In for Pricing
View Details
RN-tre Antibody
C19466-02 100 µL

RN-tre Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (Biotin)
MBS6124086-01 0.1 mL

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (Biotin)

Sign In for Pricing
View Details
Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (Biotin)
MBS6124086-02 5x 0.1 mL

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (Biotin)

Sign In for Pricing
View Details