Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Mouse (HEK293, hFc-His)

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes.This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications.Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding.L-selectin/CD62L Protein, Mouse (HEK293, hFc-His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-6*His, C-Fc labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Mouse (HEK293, hFc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-mouse-hek-293-his.html

Purity

97.00

Smiles

WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

Molecular Formula

20343 (Gene_ID) P18337 (W39-N332) (Accession)

Molecular Weight

90-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Meta-Pneumovirus Antibody (HMPV123) [mFluor Violet 450 SE]
NBP1-21631MFV450 0.1 mL

Mouse Monoclonal Meta-Pneumovirus Antibody (HMPV123) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
NKX28 Antibody
MBS8588753-01 0.1 mg

NKX28 Antibody

Sign In for Pricing
View Details
NKX28 Antibody
MBS8588753-02 0.1 mL (AF405L)

NKX28 Antibody

Sign In for Pricing
View Details
NKX28 Antibody
MBS8588753-03 0.1 mL (AF405S)

NKX28 Antibody

Sign In for Pricing
View Details
NKX28 Antibody
MBS8588753-04 0.1 mL (AF610)

NKX28 Antibody

Sign In for Pricing
View Details
NKX28 Antibody
MBS8588753-05 0.1 mL (AF635)

NKX28 Antibody

Sign In for Pricing
View Details