Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-selectin/CD62L, Mouse (HEK293, hFc-His)

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes.This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications.Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding.L-selectin/CD62L Protein, Mouse (HEK293, hFc-His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-6*His, C-Fc labeled tag.

Product Specifications

Product Name Alternative

L-selectin/CD62L Protein, Mouse (HEK293, hFc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-mouse-hek-293-his.html

Purity

97.00

Smiles

WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

Molecular Formula

20343 (Gene_ID) P18337 (W39-N332) (Accession)

Molecular Weight

90-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin-1 (GAL1, LGALS1, GAL-1, Lectin Galactoside-binding Soluble 1, Beta-galactoside-binding Lectin L-14-I, Lactose-binding Lectin 1, S-Lac Lectin 1, Galaptin, 14kD Laminin Binding Protein, 14kD Lectin, HLBP14, HPL, HBL, Putative MAPK-activating Protein PM12, GBP, DKFZp686E23103) (MaxLight 405) discontinued
143574-ML405 100 µL

Galectin-1 (GAL1, LGALS1, GAL-1, Lectin Galactoside-binding Soluble 1, Beta-galactoside-binding Lectin L-14-I, Lactose-binding Lectin 1, S-Lac Lectin 1, Galaptin, 14kD Laminin Binding Protein, 14kD Lectin, HLBP14, HPL, HBL, Putative MAPK-activating Protein PM12, GBP, DKFZp686E23103) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MLH1 Antibody / MutL Homolog 1
V8749-20UG 20 µg

MLH1 Antibody / MutL Homolog 1

Sign In for Pricing
View Details
FOXH1 (Forkhead Box H1, Human Homolog of Xenopus Forkhead Activin Signal Transducer 1)
MBS620886-01 0.1 mg

FOXH1 (Forkhead Box H1, Human Homolog of Xenopus Forkhead Activin Signal Transducer 1)

Sign In for Pricing
View Details
FOXH1 (Forkhead Box H1, Human Homolog of Xenopus Forkhead Activin Signal Transducer 1)
MBS620886-02 5x 0.1 mg

FOXH1 (Forkhead Box H1, Human Homolog of Xenopus Forkhead Activin Signal Transducer 1)

Sign In for Pricing
View Details
Olfr1276 (NM_146395) Mouse Tagged Lenti ORF Clone
MR214945L4 10 µg

Olfr1276 (NM_146395) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MDL 72527 (free base)
HY-W680647 1 Each

MDL 72527 (free base)

Sign In for Pricing
View Details