Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synapsin-2 (Syn2), partial

Product Specifications

Product Name Alternative

(Synapsin II)

Abbreviation

Recombinant Rat Syn2 protein, partial

Gene Name

Syn2

UniProt

Q63537

Expression Region

88-422aa

Organism

Rattus norvegicus (Rat)

Target Sequence

LSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSRT

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. May play a role in noradrenaline secretion by sympathetic neurons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.4 kDa

References & Citations

"A cytosolic splice variant of Cab45 interacts with Munc18b and impacts on amylase secretion by pancreatic acini." Lam P.P., Hyvaerinen K., Kauppi M., Cosen-Binker L., Laitinen S., Keraenen S., Gaisano H.Y., Olkkonen V.M. Mol. Biol. Cell 18:2473-2480 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-01 0.02 mg (E-Coli)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-02 0.1 mg (E-Coli)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-03 0.02 mg (Yeast)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-04 0.1 mg (Yeast)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-05 0.02 mg (Baculovirus)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein IRL13
MBS1103792-06 0.02 mg (Mammalian-Cell)

Recombinant Human cytomegalovirus Uncharacterized protein IRL13

Sign In for Pricing
View Details