Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor A ; NKEF-AProliferation-associated gene protein ; PAGThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2

Abbreviation

Recombinant Human PRDX1 protein

Gene Name

PRDX1

UniProt

Q06830

Expression Region

1-199aa

Organism

Homo sapiens (Human)

Target Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin syst but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H (2) O (2)

Molecular Weight

49.1 kDa

References & Citations

A human cDNA corresponding to a gene overexpressed during cell proliferation encodes a product sharing homology with amoebic and bacterial proteins.Prosperi M.T., Ferbus D., Karczinski I., Goubin G.J. Biol. Chem. 268:11050-11056 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFN-alpha/beta R2, C-His Tag (ECD)
HA210608-01 20 µg

Human IFN-alpha/beta R2, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IFN-alpha/beta R2, C-His Tag (ECD)
HA210608-02 50 µg

Human IFN-alpha/beta R2, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IFN-alpha/beta R2, C-His Tag (ECD)
HA210608-03 100 µg

Human IFN-alpha/beta R2, C-His Tag (ECD)

Sign In for Pricing
View Details
PNMA3 Human Gene Knockout Kit (CRISPR)
KN418987 1 Kit

PNMA3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fluorescence Spectrophotometer BSFL-102
BSFL-102 1 Unit

Fluorescence Spectrophotometer BSFL-102

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), 0.2mg/mL
BNUB2173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), 0.2mg/mL

Sign In for Pricing
View Details