Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (His) is the recombinant rat-derived SCF protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 (NRF1/2609), CF647 conjugate, 0.1mg/mL
BNC472609-500 1x 500 µL

NRF1 (NRF1/2609), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Insulin-like Growth Factor-1 (IGF-1, Insulin-like Growth Factor IA (IGF-IA), Insulin-like Growth Factor IB (IGF-IB), Mechano Growth Factor (MGF), Somatomedin-C)
168810-01 20 µg

Insulin-like Growth Factor-1 (IGF-1, Insulin-like Growth Factor IA (IGF-IA), Insulin-like Growth Factor IB (IGF-IB), Mechano Growth Factor (MGF), Somatomedin-C)

Sign In for Pricing
View Details
Insulin-like Growth Factor-1 (IGF-1, Insulin-like Growth Factor IA (IGF-IA), Insulin-like Growth Factor IB (IGF-IB), Mechano Growth Factor (MGF), Somatomedin-C)
168810-02 100 µg

Insulin-like Growth Factor-1 (IGF-1, Insulin-like Growth Factor IA (IGF-IA), Insulin-like Growth Factor IB (IGF-IB), Mechano Growth Factor (MGF), Somatomedin-C)

Sign In for Pricing
View Details
LTV1 (NM_032860) Human Recombinant Protein
PH31156E6 50 µg

LTV1 (NM_032860) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF814 Protein Vector (Human) (pPB-N-His)
PV145723 500 ng

ZNF814 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PE Mouse Anti-human IgM Antibody *CH2, monoclonal*
V1031530-AAT 0.1 mg

PE Mouse Anti-human IgM Antibody *CH2, monoclonal*

Sign In for Pricing
View Details