Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial

Product Specifications

Product Name Alternative

P30

Abbreviation

Recombinant Toxoplasma gondii GRA3 protein, partial

Gene Name

GRA3

UniProt

B6KEU8

Expression Region

43-114aa

Organism

Toxoplasma gondii

Target Sequence

ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.8 kDa

References & Citations

"Interaction between parasitophorous vacuolar membrane-associated GRA3 and calcium modulating ligand of host cell endoplasmic reticulum in the parasitism of Toxoplasma gondii." Kim J.Y., Ahn H.J., Ryu K.J., Nam H.W. Korean J. Parasitol. 46:209-216 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEUTX Human Gene Knockout Kit (CRISPR)
KN426593 1 Kit

LEUTX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Apolipoprotein A2 (APOA2) ELISA Kit
RDR-APOA2-Mu-01 96 Tests

Mouse Apolipoprotein A2 (APOA2) ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein A2 (APOA2) ELISA Kit
RDR-APOA2-Mu-02 48 Tests

Mouse Apolipoprotein A2 (APOA2) ELISA Kit

Sign In for Pricing
View Details
CST6 (NM_001323) Human Recombinant Protein
TP307689 20 µg

CST6 (NM_001323) Human Recombinant Protein

Sign In for Pricing
View Details
Tbxas1 Mouse Gene Knockout Kit (CRISPR)
KN517297 1 Kit

Tbxas1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POMT1 (C-term) Rabbit Polyclonal Antibody
AP53389PU-N 400 µL

POMT1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details