Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Wnt-6 (Wnt6)

Product Specifications

Product Name Alternative

Protein Wnt-6

Abbreviation

Recombinant Mouse Wnt6 protein

Gene Name

Wnt6

UniProt

P22727

Expression Region

24-364aa

Organism

Mus musculus (Mouse)

Target Sequence

LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.2 kDa

References & Citations

"WNT6 is a novel target gene of caveolin-1 promoting chemoresistance to epirubicin in human gastric cancer cells." Yuan G., Regel I., Lian F., Friedrich T., Hitkova I., Hofheinz R.D., Stroebel P., Langer R., Keller G., Roecken C., Zimmermann W., Schmid R.M., Ebert M.P.A., Burgermeister E. Oncogene 32:375-387 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gfpt1 Mouse Gene Knockout Kit (CRISPR)
KN306419BN 1 Kit

Gfpt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR21 Human Gene Knockout Kit (CRISPR)
KN209685BN 1 Kit

GPR21 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Glycine max Lectin (Soybean) -SBA-
L-1301-5 1 mg

Pure Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details
Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody
E-AB-V1302-01 200 µL

Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody
E-AB-V1302-02 500 µL

Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody

Sign In for Pricing
View Details
1-Benzoyl-4-(2,3-dichlorophenyl)piperazine 4-Oxide
TRC-B276160-50MG 50 mg

1-Benzoyl-4-(2,3-dichlorophenyl)piperazine 4-Oxide

Sign In for Pricing
View Details