Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Pregnancy-associated glycoprotein 2 (PAG2)

Product Specifications

Product Name Alternative

PAG 2

Abbreviation

Recombinant Bovine PAG2 protein

Gene Name

PAG2

UniProt

Q28057

Expression Region

22-376aa

Organism

Bos taurus (Bovine)

Target Sequence

KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.1 kDa

References & Citations

"The glycosylation of pregnancy-associated glycoproteins and prolactin-related protein-I in bovine binucleate trophoblast giant cells changes before parturition." Klisch K., Boos A., Friedrich M., Herzog K., Feldmann M., Sousa N., Beckers J., Leiser R., Schuler G. Reproduction 132:791-798 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Biotin Dimer Acid
TRC-B390650-25MG 25 mg

D-Biotin Dimer Acid

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), CF488A conjugate, 0.1mg/mL
BNC883286-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2421), CF568 conjugate, 0.1mg/mL
BNC682421-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Sulfobenzaldehyde Hydrate
TRC-S689160-50MG 50 mg

3-Sulfobenzaldehyde Hydrate

Sign In for Pricing
View Details
CD68 (CD68/G2), 0.2mg/mL
BNUB0919-500 1x 500 µL

CD68 (CD68/G2), 0.2mg/mL

Sign In for Pricing
View Details
KCNC3 Goat Polyclonal Antibody
AP31842PU-N 100 µg

KCNC3 Goat Polyclonal Antibody

Sign In for Pricing
View Details