Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell receptor CD22 (CD22), partial, Biotinylated

Product Specifications

Product Name Alternative

(B-lymphocyte cell adhesion molecule) (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD antigen CD22)

Abbreviation

Recombinant Human CD22 protein, partial, Biotinylated

Gene Name

CD22

UniProt

P20273

Expression Region

20-687aa

Organism

Homo sapiens (Human)

Target Sequence

DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

Tag

C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

79.2 kDa

References & Citations

"The B-cell antigen CD22 mediates monocyte and erythrocyte adhesion." Stamenkovic I., Seed B. Nature 345:74-77 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED4 Polyclonal Antibody
E-AB-17108-01 20 µL

TMED4 Polyclonal Antibody

Sign In for Pricing
View Details
TMED4 Polyclonal Antibody
E-AB-17108-02 60 µL

TMED4 Polyclonal Antibody

Sign In for Pricing
View Details
TMED4 Polyclonal Antibody
E-AB-17108-03 120 µL

TMED4 Polyclonal Antibody

Sign In for Pricing
View Details
TMED4 Polyclonal Antibody
E-AB-17108-04 200 µL

TMED4 Polyclonal Antibody

Sign In for Pricing
View Details
pep1 Rabbit Polyclonal Antibody
TA396956S 25 µL

pep1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI28F12]
TA807865AM 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI28F12]

Sign In for Pricing
View Details