Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IHH, Human

IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.

Product Specifications

Product Name Alternative

IHH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/ihh-protein-human.html

Purity

98.0

Smiles

GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

Molecular Formula

3549 (Gene_ID) Q14623 (G29-G202) (Accession)

Molecular Weight

Approximately 20 kDa

References & Citations

[1]Van den Brink GR, et al. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation. Nat Genet. 2004 Mar;36 (3) :277-82. Epub 2004 Feb 8.|[2]St-Jacques B, et al. Indian hedgehog signaling regulates proliferation and differentiation of chondrocytes and is essential for bone formation. Genes Dev. 1999 Aug 15;13 (16) :2072-86.|[3]Vortkamp A, et al. Regulation of rate of cartilage differentiation by Indian hedgehog and PTH-related protein. Science. 1996 Aug 2;273 (5275) :613-22.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B) (MaxLight 750) discontinued
044011-ML750 100 µL

ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B) (MaxLight 750) discontinued

Sign In for Pricing
View Details
pCMV-FCGR1A-λN22-YSA-Puro Plasmid
PVT47693 2 µg

pCMV-FCGR1A-λN22-YSA-Puro Plasmid

Sign In for Pricing
View Details
alpha Adducin (ADD1) (NM_001119) Human Tagged Lenti ORF Clone
RC223881L3 10 µg

alpha Adducin (ADD1) (NM_001119) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
3- (2-Chloroethyl) -9-hydroxy-2-methyl-4H-Pyrido[1,2-a]pyrimidin-4-one Hydrochloride
422427 25 mg

3- (2-Chloroethyl) -9-hydroxy-2-methyl-4H-Pyrido[1,2-a]pyrimidin-4-one Hydrochloride

Sign In for Pricing
View Details
CCR7 (CD197) Antibody
E021500-2 100 µg -100 µL

CCR7 (CD197) Antibody

Sign In for Pricing
View Details
PLAUR Protein Vector (Rat) (pPM-C-His)
PV294421 500 ng

PLAUR Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details