Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEMK2, Human (His)

Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HEMK2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemk2-protein-human-his.html

Purity

96.40

Smiles

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Molecular Formula

29104 (Gene_ID) Q9Y5N5-2 (M1-S186) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAPP2 / PLEKHA8 Immunizing Peptide
MBS425227-01 0.1 mg

FAPP2 / PLEKHA8 Immunizing Peptide

Sign In for Pricing
View Details
FAPP2 / PLEKHA8 Immunizing Peptide
MBS425227-02 5x 0.1 mg

FAPP2 / PLEKHA8 Immunizing Peptide

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag
058445-01 10 µg

Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag
058445-02 50 µg

Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag
058445-03 100 µg

Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag
058445-04 200 µg

Transient Receptor Potential Cation Channel Subfamily V, Member 6 (TRPV6), RCecombinant, Human, His-Tag

Sign In for Pricing
View Details