Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human herpesvirus 6A gB protein, partial

Gene Name

GB

UniProt

P28864

Expression Region

23-188aa

Organism

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Target Sequence

DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

References & Citations

"The DNA sequence of human herpesvirus-6: structure, coding content, and genome evolution." Gompels U.A., Nicholas J., Lawrence G.L., Jones M., Thomson B.J., Martin M.E.D., Efstathiou S., Craxton M.A., Macaulay H.A. Virology 209:29-51 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrobenzaldehyde Semicarbazone
TRC-N492150-250MG 250 mg

2-Nitrobenzaldehyde Semicarbazone

Sign In for Pricing
View Details
BDNF (NM_001143811) Human Over-expression Lysate
LC428357 20 µg

BDNF (NM_001143811) Human Over-expression Lysate

Sign In for Pricing
View Details
Magnesium Stearate
TRC-M110345-500G 500 g

Magnesium Stearate

Sign In for Pricing
View Details
DNAJC15 (NM_013238) Human Over-expression Lysate
LC402228 20 µg

DNAJC15 (NM_013238) Human Over-expression Lysate

Sign In for Pricing
View Details
MAPT / TAU Chicken Polyclonal Antibody
AP32982SU-N 100 µL

MAPT / TAU Chicken Polyclonal Antibody

Sign In for Pricing
View Details
MYO18A Human Gene Knockout Kit (CRISPR)
KN216905BN 1 Kit

MYO18A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details