Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SECTM1, Human (HEK293, hFc)

SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, hFc) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

SECTM1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sectm1-protein-human-hek-293-hfc.html

Purity

90.0

Smiles

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Molecular Formula

6398 (Gene_ID) Q8WVN6 (Q29-G145) (Accession)

Molecular Weight

Approximately 46 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

β-1,3-Gal-T2 Rabbit Polyclonal Antibody
E28PT5003 100 µL

β-1,3-Gal-T2 Rabbit Polyclonal Antibody

Ask
View Details
SRP9 (Signal Recognition Particle 9kDa) Chicken ELISA Kit
H2984 96 Tests

SRP9 (Signal Recognition Particle 9kDa) Chicken ELISA Kit

Ask
View Details
CRAT siRNA (Rat)
CRR5352-01 15 nmol

CRAT siRNA (Rat)

Ask
View Details
CRAT siRNA (Rat)
CRR5352-02 30 nmol

CRAT siRNA (Rat)

Ask
View Details
RIT2, NT (RIT2, RIN, ROC2, GTP-binding protein Rit2, Ras-like protein expressed in neurons, Ras-like without CAAX protein 2) (PE)
MBS6342224-01 0.2 mL

RIT2, NT (RIT2, RIN, ROC2, GTP-binding protein Rit2, Ras-like protein expressed in neurons, Ras-like without CAAX protein 2) (PE)

Ask
View Details
RIT2, NT (RIT2, RIN, ROC2, GTP-binding protein Rit2, Ras-like protein expressed in neurons, Ras-like without CAAX protein 2) (PE)
MBS6342224-02 5x 0.2 mL

RIT2, NT (RIT2, RIN, ROC2, GTP-binding protein Rit2, Ras-like protein expressed in neurons, Ras-like without CAAX protein 2) (PE)

Ask
View Details