Recombinant Leiurus hebraeus Alpha-like toxin Lqh7
Product Specifications
Product Name Alternative
Lqh VII (LqhVII)
Abbreviation
Recombinant Leiurus hebraeus Alpha-like toxin Lqh7 protein
UniProt
P59357
Expression Region
1-66aa
Organism
Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Target Sequence
VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
Developed Protein
Source
Baculovirus
Field of Research
Others
Relevance
Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is highly toxic to insects and mice, and inhibits the binding of alpha-toxin to cockroach neuronal membranes.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
10.7 kDa
References & Citations
"Moving pieces in a taxonomic puzzle: venom 2D-LC/MS and data clustering analyses to infer phylogenetic relationships in some scorpions from the Buthidae family (Scorpiones) ." Nascimento D.G., Rates B., Santos D.M., Verano-Braga T., Barbosa-Silva A., Dutra A.A.A., Biondi I., Martin-Eauclaire M.-F., De Lima M.E., Pimenta A.M.C. Toxicon 47:628-639 (2006)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740977-500 1x 500 µL
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details