Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)
Product Specifications
CAS Number
9000-83-3
Gene Name
ATP5MF
UniProt
P56134
Expression Region
1-94aa
Organism
Homo sapiens
Target Sequence
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Tag
N-terminal 10xHis-tagged
Source
in vitro E.coli expression system
Field of Research
Others
Assay Type
CF Transmembrane Protein & In Stock Protein
Relevance
Mitochondrial membrane ATP synthase (F (1)F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain. Minor subunit located with subunit a in the membrane.
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Length
Full Length
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
12.4 kDa
References & Citations
"Dimer ribbons of ATP synthase shape the inner mitochondrial membrane."
Strauss M., Hofhaus G., Schroder R.R., Kuhlbrandt W.
EMBO J 27:1154-1160 (2008)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog