Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cancer/testis antigen 1 (CTAG1A)

Product Specifications

Product Name Alternative

CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1

Abbreviation

Recombinant Human CTAG1A protein

Gene Name

CTAG1A

UniProt

P78358

Expression Region

1-180aa

Organism

Homo sapiens (Human)

Target Sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Autoimmunogenic cancer/testis antigen NY-ESO-1 (Cancer/testis antigen 6.1) (CT6.1) (L antigen family member 2) (LAGE-2) (CTAG) (CTAG1) (ESO1) (LAGE2) (LAGE2A)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.1 kDa

References & Citations

"Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes." Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L. Hum. Mol. Genet. 10:2557-2567 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF405S conjugate, 0.1mg/mL
BNC042230-500 1x 500 µL

FOXA1 / HNF3A (FOXA1/2230R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details