Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MD-2/LY96, Mouse (HEK293, Fc)

MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact.This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities.MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

MD-2/LY96 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/md-2-ly96-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Molecular Formula

17087 (Gene_ID) Q9JHF9 (E19-N160) (Accession)

Molecular Weight

Approximately 47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF488A conjugate, 0.1mg/mL
BNC881384-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL
BNC041475-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details