Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human.html

Purity

97.00

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225 (G35-N146) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205 (11) :2595-608. |[2]Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181 (7) :4656-65.|[3]Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354) . Clin Exp Allergy. 2005 Aug;35 (8) :1096-103. |[4]de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151 (11) :6370-81. |[5]May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166 (1) :177-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnab2 Mouse Monoclonal Antibody [Clone ID: K17/70]
75-021 100 µL

Kcnab2 Mouse Monoclonal Antibody [Clone ID: K17/70]

Sign In for Pricing
View Details
Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
E-UNEL-H0336-01 5x 96 Tests

Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
E-UNEL-H0336-02 15x 96 Tests

Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
NELL1 (NM_201551) Human Over-expression Lysate
LY430874 100 µg

NELL1 (NM_201551) Human Over-expression Lysate

Sign In for Pricing
View Details
Melperone Hydrochloride
TRC-M216800-50MG 50 mg

Melperone Hydrochloride

Sign In for Pricing
View Details
TRITC Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-
R-3101-1 1 mg

TRITC Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-

Sign In for Pricing
View Details