Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human.html

Purity

97.00

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225 (G35-N146) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205 (11) :2595-608. |[2]Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181 (7) :4656-65.|[3]Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354) . Clin Exp Allergy. 2005 Aug;35 (8) :1096-103. |[4]de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151 (11) :6370-81. |[5]May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166 (1) :177-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PIP1;1, PIP1;2, PIP1;3, PIP1;4, PIP1;5 | Aquaporins
AS22 4816 50 µg

Anti-PIP1;1, PIP1;2, PIP1;3, PIP1;4, PIP1;5 | Aquaporins

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H9]
TA802457BM 100 µL

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H9]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total R10Z8E9,  30nm
GM-209-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total R10Z8E9, 30nm

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 NP CTD domain V2 (C-6His)
PKSV030279 1 mg

Recombinant SARS-CoV-2 NP CTD domain V2 (C-6His)

Sign In for Pricing
View Details
Anti-F3
Y058619 100 µg

Anti-F3

Sign In for Pricing
View Details
Recombinant Mouse CD27 Protein (His Tag)
PDMM100225-01 20 µg

Recombinant Mouse CD27 Protein (His Tag)

Sign In for Pricing
View Details