Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human.html

Purity

97.00

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225 (G35-N146) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205 (11) :2595-608. |[2]Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181 (7) :4656-65.|[3]Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354) . Clin Exp Allergy. 2005 Aug;35 (8) :1096-103. |[4]de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151 (11) :6370-81. |[5]May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166 (1) :177-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT
E1192Ra-01 48 Well

Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT

Sign In for Pricing
View Details
Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT
E1192Ra-02 96 Well

Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT

Sign In for Pricing
View Details
Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT
E1192Ra-03 5x 96 Tests

Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT

Sign In for Pricing
View Details
Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT
E1192Ra-04 10x 96 Tests

Rat COP9 signalosome compex subunit 1, GPS1 ELISA KIT

Sign In for Pricing
View Details
vpx Antibody, FITC conjugated
A50413-100UG 100 µg

vpx Antibody, FITC conjugated

Sign In for Pricing
View Details
Hsa-miR-3937 antagomir
HY-RI00897A-01 5 nmol

Hsa-miR-3937 antagomir

Sign In for Pricing
View Details