TAFA1/FAM19A1, Human
The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TAFA1/FAM19A1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tafa1-fam19a1-protein-human.html
Purity
96.40
Smiles
SLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT
Molecular Formula
407738 (Gene_ID) Q7Z5A9/NP_998774 (S26-T133) (Accession)
Molecular Weight
Approximately 12.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
LCP1, ID (LCP1, PLS2, Plastin-2, L-plastin, LC64P, Lymphocyte cytosolic protein 1) (Biotin)
LCP1, ID (LCP1, PLS2, Plastin-2, L-plastin, LC64P, Lymphocyte cytosolic protein 1) (Biotin)
Dog/Canine Chemokine Like Factor Superfamily 6 CKLFSF6 ELISA Kit
Rat Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12) ELISA Kit
Rat Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12) ELISA Kit