Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSEN34 sgRNA CRISPR Lentivector set (Human)
K2538601 3x 1.0 µg

TSEN34 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YIL001W Polyclonal Antibody
MBS9000745 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YIL001W Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Rabbit anti-Human/Monkey HLA-DR mAb
A27380-01 100 Tests

Biotin Rabbit anti-Human/Monkey HLA-DR mAb

Sign In for Pricing
View Details
Biotin Rabbit anti-Human/Monkey HLA-DR mAb
A27380-02 200 Tests

Biotin Rabbit anti-Human/Monkey HLA-DR mAb

Sign In for Pricing
View Details
Biotin Rabbit anti-Human/Monkey HLA-DR mAb
A27380-03 500 Tests

Biotin Rabbit anti-Human/Monkey HLA-DR mAb

Sign In for Pricing
View Details
C16orf95 (NM_001195124) Human Tagged ORF Clone
RG231086 10 µg

C16orf95 (NM_001195124) Human Tagged ORF Clone

Sign In for Pricing
View Details