Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FABP6 Antibody (009)
NBP2-90126-100ul 100 µL

Rabbit Monoclonal FABP6 Antibody (009)

Sign In for Pricing
View Details
Lentiviral mouse Nt5e shRNA (UAS) - Lentiviral mouse Nt5e shRNA (UAS, iRFP) (100)
GTR15260967 1 Vial

Lentiviral mouse Nt5e shRNA (UAS) - Lentiviral mouse Nt5e shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human ZACN qPCR Primer Pair
QH74317S 200 Tests

Human ZACN qPCR Primer Pair

Sign In for Pricing
View Details
Haus8 (NM_001024971) Rat Tagged ORF Clone Lentiviral Particle
RR201879L3V 200 µL

Haus8 (NM_001024971) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal FATP2/SLC27A2 Antibody (466106) [Alexa Fluor 594]
FAB4659T 0.1 mL

Mouse Monoclonal FATP2/SLC27A2 Antibody (466106) [Alexa Fluor 594]

Sign In for Pricing
View Details
IOLILYTE ZBE 0100
ZBE-0100-HP-1000 1000 g

IOLILYTE ZBE 0100

Sign In for Pricing
View Details