Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf42 sgRNA CRISPR Lentivector set (Human)
K0231101 3x 1.0 µg

C3orf42 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal TXNDC5 Antibody (2E7/7) [DyLight 405]
NBP2-22414V 0.1 mL

Mouse Monoclonal TXNDC5 Antibody (2E7/7) [DyLight 405]

Sign In for Pricing
View Details
Magnetic bottle holder for 250 ml bottle
800079 1 Piece

Magnetic bottle holder for 250 ml bottle

Sign In for Pricing
View Details
Eif4e2 ORF Vector (Mouse) (pORF)
ORF043780 1.0 µg DNA

Eif4e2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Dipyridamole Tetra-O-β-D-glucuronide
sc-497902 1 mg

Dipyridamole Tetra-O-β-D-glucuronide

Sign In for Pricing
View Details
Salmonella Matched Antibody Pair Set [ABP-S-052859]
ABP-S-052859 5 Plates

Salmonella Matched Antibody Pair Set [ABP-S-052859]

Sign In for Pricing
View Details