Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oligo, Restriction Site, Smal I (Xmal Imer) (8mer)
MBS634186-01 0.033 mg

Oligo, Restriction Site, Smal I (Xmal Imer) (8mer)

Sign In for Pricing
View Details
Oligo, Restriction Site, Smal I (Xmal Imer) (8mer)
MBS634186-02 5x 0.033 mg

Oligo, Restriction Site, Smal I (Xmal Imer) (8mer)

Sign In for Pricing
View Details
Human ZNF571 (NM_016536) AAV Particle
RC211426A1V 250 µL

Human ZNF571 (NM_016536) AAV Particle

Sign In for Pricing
View Details
hsa-miR-1912 miRNA Inhibitor
MIH01442 2x 5.0 nmol

hsa-miR-1912 miRNA Inhibitor

Sign In for Pricing
View Details
Mouse Ppan activation kit by CRISPRa
GA214591 1 Kit

Mouse Ppan activation kit by CRISPRa

Sign In for Pricing
View Details
Htr1d (NM_008309) Mouse Tagged Lenti ORF Clone
MR217452L4 10 µg

Htr1d (NM_008309) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details