Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Canine GDF15 (Growth Differentiation Factor 15) ELISA
KLN0997 1x 96 Well

GENLISA Canine GDF15 (Growth Differentiation Factor 15) ELISA

Sign In for Pricing
View Details
Olr773 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7487102 1.0 µg DNA

Olr773 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TRNAQ30 sgRNA CRISPR Lentivector set (Human)
K2515801 3x 1.0 µg

TRNAQ30 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Virolongin B
MF-0024279-01 5 mg

Virolongin B

Sign In for Pricing
View Details
Virolongin B
MF-0024279-02 1 mg

Virolongin B

Sign In for Pricing
View Details
Serum-Free Medium for Mouse Lymphocyte
6211011 250 mL

Serum-Free Medium for Mouse Lymphocyte

Sign In for Pricing
View Details