Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neural Cell Adhesion Molecule (NCAM) Antibody
abx173750-01 100 µL

Neural Cell Adhesion Molecule (NCAM) Antibody

Sign In for Pricing
View Details
Neural Cell Adhesion Molecule (NCAM) Antibody
abx173750-02 200 µL

Neural Cell Adhesion Molecule (NCAM) Antibody

Sign In for Pricing
View Details
Neural Cell Adhesion Molecule (NCAM) Antibody
abx173750-03 1 mL

Neural Cell Adhesion Molecule (NCAM) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Wdr46 shRNA (UAS) - Lentiviral mouse Wdr46 shRNA (UAS, RFP) (100)
GTR15269484 1 Vial

Lentiviral mouse Wdr46 shRNA (UAS) - Lentiviral mouse Wdr46 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Frmd4b 3'UTR GFP Stable Cell Line
TU156734 1.0 mL

Frmd4b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal GLYAT Antibody [Janelia Fluor 646]
NBP2-99587JF646 0.1 mL

Rabbit Polyclonal GLYAT Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details