Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wwp1 (BC026829) Mouse Tagged ORF Clone
MR210655 10 µg

Wwp1 (BC026829) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Nori® Human Pax6 ELISA Kit
GR111354 96 Well

Nori® Human Pax6 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PTDSS1 sgRNA gene knockout kit - Lentiviral human PTDSS1 sgRNA gene knockout kit (25)
GTR15385605 1 Vial

Lentiviral human PTDSS1 sgRNA gene knockout kit - Lentiviral human PTDSS1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
OR8U9
487793 100 µL

OR8U9

Sign In for Pricing
View Details
hsa-miR-1250-3p miRNA Inhibitor
MIH01135 2x 5.0 nmol

hsa-miR-1250-3p miRNA Inhibitor

Sign In for Pricing
View Details
Giardia Lamblia Cysts
NAT41660-100 1 Each

Giardia Lamblia Cysts

Sign In for Pricing
View Details