Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (P. pastoris, N-His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGFR-3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-p-pastoris-n-his.html

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ostc Rat shRNA Lentiviral Particle (Locus ID 362040)
TL707100V 500 µL Each

Ostc Rat shRNA Lentiviral Particle (Locus ID 362040)

Sign In for Pricing
View Details
Bovine E3 ubiquitin-protein ligase TRAF7 (TRAF7) ELISA Kit
EIA06868Bo 1 Kit

Bovine E3 ubiquitin-protein ligase TRAF7 (TRAF7) ELISA Kit

Sign In for Pricing
View Details
Crotonaldehyde 2,4-Dinitrophenylhydrazone-d3
TRC-C818702-10MG 10 mg

Crotonaldehyde 2,4-Dinitrophenylhydrazone-d3

Sign In for Pricing
View Details
Anti-Phospho-Casein Kinase alpha (Y321) antibody
STJ90552 200 µl

Anti-Phospho-Casein Kinase alpha (Y321) antibody

Sign In for Pricing
View Details
Rabbit Ly6/PLAUR domain-containing protein 6B (LYPD6B) ELISA Kit
MBS7211290-01 48 Well

Rabbit Ly6/PLAUR domain-containing protein 6B (LYPD6B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Ly6/PLAUR domain-containing protein 6B (LYPD6B) ELISA Kit
MBS7211290-02 96 Well

Rabbit Ly6/PLAUR domain-containing protein 6B (LYPD6B) ELISA Kit

Sign In for Pricing
View Details