Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Exoc6b Pre-designed siRNA Set B
SI104510B 1 Each

Mouse Exoc6b Pre-designed siRNA Set B

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (Biotin)
250911-Biotin 100 µL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (Biotin)

Sign In for Pricing
View Details
PCDH17 Protein Vector (Mouse) (pPB-N-His)
PV213923 500 ng

PCDH17 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal RFX1 Antibody [FITC]
NBP1-52653F 0.1 mL

Rabbit Polyclonal RFX1 Antibody [FITC]

Sign In for Pricing
View Details
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
AP06547PU-N 100 µg

NMDAR1 (GRIN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2R,3R,11bS) -Dihydrotetrabenazine D-Val
421643-01 1 mg

(2R,3R,11bS) -Dihydrotetrabenazine D-Val

Sign In for Pricing
View Details