Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor X (F10) Mouse Monoclonal Antibody [Clone ID: OTI1B8]
TA811731S 30 µL

Factor X (F10) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Lentiviral human CAV3 shRNA (UAS) - Lentiviral human CAV3 shRNA (UAS, iRFP) (25)
GTR15083282 1 Vial

Lentiviral human CAV3 shRNA (UAS) - Lentiviral human CAV3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Hydrobromic Acid Solution (in glacial acetic Acid about 33%)
01378 00500 500 mL

Hydrobromic Acid Solution (in glacial acetic Acid about 33%)

Sign In for Pricing
View Details
Easypro Rat Mucin 1 (MUC1) ELISA Kit
FY-ER1339S 96 Well

Easypro Rat Mucin 1 (MUC1) ELISA Kit

Sign In for Pricing
View Details
RHOH (Ras Homolog Gene Family, Member H, ARHH, TTF) (MaxLight 550)
251109-ML550 100 µL

RHOH (Ras Homolog Gene Family, Member H, ARHH, TTF) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) RDS1 Polyclonal Antibody
MBS7160283 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) RDS1 Polyclonal Antibody

Sign In for Pricing
View Details