Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-5587-5p miRNA Agomir
abx881815-01 5 nmol

Human hsa-miR-5587-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-5587-5p miRNA Agomir
abx881815-02 10 nmol

Human hsa-miR-5587-5p miRNA Agomir

Sign In for Pricing
View Details
Rat Carbonic Anhydrase IX/CA9 ELISA Kit (Colorimetric)
NBP2-72509 1 Kit

Rat Carbonic Anhydrase IX/CA9 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Polyclonal STEAP2 Antibody
APR06457G 0.1 mg

Polyclonal STEAP2 Antibody

Sign In for Pricing
View Details
BCNP Polyclonal Antibody, HRP Conjugated
bs-7977R-HRP 100 µL

BCNP Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
hsa-miR-5195-5p miRNA Mimic
MCH02903 2x 2.5 nmol

hsa-miR-5195-5p miRNA Mimic

Sign In for Pricing
View Details