Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serpinf1 Pre-designed siRNA Set A
SI112743A 1 Each

Mouse Serpinf1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GTF2A1 (General Transcription Factor IIA Polypeptide 1, TF2A1, TFIIA, TFIIAL, TFIIA-42) (APC)
MBS6419655-01 0.1 mL

GTF2A1 (General Transcription Factor IIA Polypeptide 1, TF2A1, TFIIA, TFIIAL, TFIIA-42) (APC)

Sign In for Pricing
View Details
GTF2A1 (General Transcription Factor IIA Polypeptide 1, TF2A1, TFIIA, TFIIAL, TFIIA-42) (APC)
MBS6419655-02 5x 0.1 mL

GTF2A1 (General Transcription Factor IIA Polypeptide 1, TF2A1, TFIIA, TFIIAL, TFIIA-42) (APC)

Sign In for Pricing
View Details
Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)
MBS1092035-01 0.02 mg (E-Coli)

Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)
MBS1092035-02 0.02 mg (Yeast)

Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)
MBS1092035-03 0.1 mg (E-Coli)

Recombinant Campylobacter curvus Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details