Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCS1L Human qPCR Template Standard (NM_004328)
HK201080 1 Kit

BCS1L Human qPCR Template Standard (NM_004328)

Sign In for Pricing
View Details
Rabbit Monoclonal Integrin alpha E/CD103 Antibody (ITGAE/3904R) [Alexa Fluor 350]
NBP3-08855AF350 100 µL

Rabbit Monoclonal Integrin alpha E/CD103 Antibody (ITGAE/3904R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Human NRG1?beta 1 protein (N-6His)
CD01194-01 10 µg

Recombinant Human NRG1?beta 1 protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human NRG1?beta 1 protein (N-6His)
CD01194-02 50 µg

Recombinant Human NRG1?beta 1 protein (N-6His)

Sign In for Pricing
View Details
Tcstv1 (NM_018756) Mouse Tagged Lenti ORF Clone
MR212188L4 10 µg

Tcstv1 (NM_018756) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VOC Trichloroethene Neat - 10MG
REVOC114N 10 mg

VOC Trichloroethene Neat - 10MG

Sign In for Pricing
View Details