PCSK6, Human (HEK293, hFc)
The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
PCSK6 Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html
Purity
94.00
Smiles
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Molecular Formula
5046 (Gene_ID) P29122-1 (R860-G969) (Accession)
Molecular Weight
48 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein)
TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein)
Mouse Caspase 14 (CASP14) Antibody Pair Kit (with Standard)
Mouse Caspase 14 (CASP14) Antibody Pair Kit (with Standard)
Mouse Caspase 14 (CASP14) Antibody Pair Kit (with Standard)
