PCSK6, Human (HEK293, hFc)
The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
PCSK6 Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html
Purity
94.00
Smiles
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Molecular Formula
5046 (Gene_ID) P29122-1 (R860-G969) (Accession)
Molecular Weight
48 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Pack of 100 board filter discs 500g/m², 247/45 mm
Olr611 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
CD64 (CD 64, CD64 Antigen, CD64A, Fc Fragment of IgG High Affinity Ia Receptor, Fc Fragment of IgG High Affinity Ib Receptor, Fc Fragment of IgG High Affinity Ic Receptor, Fc gamma Receptor, Fc gamma Receptor I, Fc gamma RI, FCG 1, FCG1, FCGR 1, FCGR1, FcRI, Fc gamma Receptor I A1, FCGR1A, Fc gamma Receptor I B2, FCGR1B, Fc of IgG High Affinity Ia Receptor, FCGR1C, High Affinity Immunoglobulin gamma Fc Receptor I, IGFR 1, IGFR1, IGFRB, IGFRC, IgG Fc Receptor I) (PE, Cy5) discontinued