Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM60P17 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV750951 1.0 µg DNA

TRIM60P17 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Hmgb4 Pre-designed siRNA Set B
SI106233B 1 Each

Mouse Hmgb4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Lix1 qPCR Primer Pair
QM32414S 200 Tests

Mouse Lix1 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Chicken Collagen alpha-3 (IX) chain (COL9A3), partial
MBS718346 Inquire

Recombinant Chicken Collagen alpha-3 (IX) chain (COL9A3), partial

Sign In for Pricing
View Details
Recombinant Human VPS18 Protein - (Dry Ice)
H00057617-P01-25ug 25 µg

Recombinant Human VPS18 Protein - (Dry Ice)

Sign In for Pricing
View Details
PTBP2 Human Gene Knockout Kit (CRISPR)
KN402163 1 Kit

PTBP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details