Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CDKN1A/p21 (Thr145) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5237R-PE-Cy5 100 µL

Phospho-CDKN1A/p21 (Thr145) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
KRT12 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV623694 1.0 µg DNA

KRT12 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Maltodextrin (DE 17.0 - 20.0)
GC8744-1kg 1 Kg

Maltodextrin (DE 17.0 - 20.0)

Sign In for Pricing
View Details
Complete Medium for Detroit 562 Cells
abx703434 500 mL

Complete Medium for Detroit 562 Cells

Sign In for Pricing
View Details
PER8
ELKP867 20 µL Plasmid

PER8

Sign In for Pricing
View Details
Guinea pig PRF1 (Perforin 1/Pore-Forming Protein) ELISA Kit
MBS2513984-01 24 Tests

Guinea pig PRF1 (Perforin 1/Pore-Forming Protein) ELISA Kit

Sign In for Pricing
View Details