Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD3 Antibody
MBS7131741-01 0.1 mL

TEAD3 Antibody

Sign In for Pricing
View Details
TEAD3 Antibody
MBS7131741-02 5x 0.1 mL

TEAD3 Antibody

Sign In for Pricing
View Details
Larp1b (NM_001040399) Mouse Untagged Clone
MC205389 10 µg

Larp1b (NM_001040399) Mouse Untagged Clone

Sign In for Pricing
View Details
Ier2 3'UTR GFP Stable Cell Line
TU256094 1.0 mL

Ier2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FXYD1 (NM_021902) Human Untagged Clone
SC109579 10 µg

FXYD1 (NM_021902) Human Untagged Clone

Sign In for Pricing
View Details
Mep1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4010906 1.0 µg DNA

Mep1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details