Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arpc5l sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4854702 1.0 µg DNA

Arpc5l sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039309-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039309-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039309-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039309-04 1 mL

Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)
MBS2039309-05 5 mL

Cy3-Linked Polyclonal Antibody to Glycated Hemoglobin A1c (HbA1c)

Sign In for Pricing
View Details