Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcsk9 3'UTR Luciferase Stable Cell Line
TU116071 1.0 mL

Pcsk9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (Biotin)
127251-Biotin 100 µL

BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (Biotin)

Sign In for Pricing
View Details
BNP (NPPB) Mouse Monoclonal Antibody [Clone ID: OTI3H2]
CF809065 100 µg

BNP (NPPB) Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details
Filter funnels Microsart 100ml
16A07-10N 100 / PCK

Filter funnels Microsart 100ml

Sign In for Pricing
View Details
Recombinant Pseudotsuga menziesii Nucleoside diphosphate kinase 1
MBS1080581-01 0.02 mg (E-Coli)

Recombinant Pseudotsuga menziesii Nucleoside diphosphate kinase 1

Sign In for Pricing
View Details
Recombinant Pseudotsuga menziesii Nucleoside diphosphate kinase 1
MBS1080581-02 0.1 mg (E-Coli)

Recombinant Pseudotsuga menziesii Nucleoside diphosphate kinase 1

Sign In for Pricing
View Details