Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6, Human (HEK293, hFc)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PCSK6 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pcsk6-protein-human-hek293-hfc.html

Purity

94.00

Smiles

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Formula

5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

Molecular Weight

48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse V1rd18 shRNA (UAS) - Lentiviral mouse V1rd18 shRNA (UAS) plasmid
GTR15170407 1 Vial

Lentiviral mouse V1rd18 shRNA (UAS) - Lentiviral mouse V1rd18 shRNA (UAS) plasmid

Request Quote
View Details
Rabbit Monoclonal Oncostatin M/OSM Antibody (8O8K9)
NBP3-16686-100ul 100 µL

Rabbit Monoclonal Oncostatin M/OSM Antibody (8O8K9)

Request Quote
View Details
MiniPig Small Intestine, Jejenum Total RNA
NR-308 0.1 mg

MiniPig Small Intestine, Jejenum Total RNA

Request Quote
View Details
Arl5b (NM_029466) Mouse Tagged ORF Clone Lentiviral Particle
MR201621L3V 200 µL

Arl5b (NM_029466) Mouse Tagged ORF Clone Lentiviral Particle

Request Quote
View Details
Rabbit Polyclonal DHRSX Antibody [CoraFluor 1]
NBP2-97560CL1 0.1 mL

Rabbit Polyclonal DHRSX Antibody [CoraFluor 1]

Request Quote
View Details