Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFB127, Human (HEK293, Fc)

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

DEFB127 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/defb127-protein-human-hek293-fc.html

Purity

98.0

Smiles

LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

Molecular Formula

140850 (Gene_ID) Q9H1M4 (L21-C63) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SH2D6 shRNA (UAS) - Lentiviral human SH2D6 shRNA (UAS, GFP) (100)
GTR15337248 1 Vial

Lentiviral human SH2D6 shRNA (UAS) - Lentiviral human SH2D6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TAF7L Protein Vector (Human) (pPB-C-His)
PV134594 500 ng

TAF7L Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PAG3 (ASAP2) (NM_001135191) Human Tagged ORF Clone
RC226279 10 µg

PAG3 (ASAP2) (NM_001135191) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE anti-human CD4
GT06817 100 µg

PE anti-human CD4

Sign In for Pricing
View Details
UBE2G2 Antibody - N-terminal region
OAAB15722-400UL 400 µL

UBE2G2 Antibody - N-terminal region

Sign In for Pricing
View Details
Tuftsin
070-79 5 mg

Tuftsin

Sign In for Pricing
View Details