Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta-specific protein 9 (PLAC9)

Product Specifications

Abbreviation

Recombinant Human PLAC9 protein

Gene Name

PLAC9

UniProt

Q5JTB6

Expression Region

23-97aa

Organism

Homo sapiens (Human)

Target Sequence

AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.0 kDa

References & Citations

"Placenta-specific 9, a putative secretory protein, induces G2/M arrest and inhibits the proliferation of human embryonic hepatic cells." Ouyang C., Pu Y.Z., Qin X.H., Shen J., Liu Q.H., Ma L., Xue L. Biosci Rep 38:BSR20180820-BSR20180820 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein Dibenzoate
TRC-F837350-250MG 250 mg

Fluorescein Dibenzoate

Sign In for Pricing
View Details
DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C10]
TA504304AM 100 µL

DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C10]

Sign In for Pricing
View Details
GFP (Ads. to Hu, Ms, Rt Serum Proteins) Rabbit Polyclonal Antibody
AP09218PU-N 100 µg

GFP (Ads. to Hu, Ms, Rt Serum Proteins) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EFHA1 (MICU2) Human qPCR Primer Pair (NM_152726)
HP217924 200 Reactions

EFHA1 (MICU2) Human qPCR Primer Pair (NM_152726)

Sign In for Pricing
View Details
LAMA4 Antibody (Biotin)
KB-3489-01 50 μL

LAMA4 Antibody (Biotin)

Sign In for Pricing
View Details
LAMA4 Antibody (Biotin)
KB-3489-02 100 µL

LAMA4 Antibody (Biotin)

Sign In for Pricing
View Details