Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin beta-7 (ITGB7), partial

Product Specifications

Product Name Alternative

Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT) .

Abbreviation

Recombinant Human ITGB7 protein, partial

Gene Name

ITGB7

UniProt

P26010

Expression Region

1-140aa

Organism

Homo sapiens (Human)

Target Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Gut homing receptor beta subunit

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.0 kDa

References & Citations

"Cloning and sequence analysis of a novel beta 2-related integrin transcript from T lymphocytes: homology of integrin cysteine-rich repeats to domain III of laminin B chains." Yuan Q., Jiang W.-M., Krissansen G.W., Watson J.D. Int. Immunol. 2:1097-1108 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-TP Protein Vector (Human) (pPB-C-His)
PV101886 500 ng

MT-TP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Amylose azure
orb2940668-01 100 mg

Amylose azure

Sign In for Pricing
View Details
Amylose azure
orb2940668-02 250 mg

Amylose azure

Sign In for Pricing
View Details
Amylose azure
orb2940668-03 50 mg

Amylose azure

Sign In for Pricing
View Details
IZUMO1 Rabbit Polyclonal Antibody (BF750)
orb2492314 100 µL

IZUMO1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
TYK2, CT (Non-receptor Tyrosine-protein Kinase TYK2) (MaxLight 490)
MBS6504244-01 0.1 mL

TYK2, CT (Non-receptor Tyrosine-protein Kinase TYK2) (MaxLight 490)

Sign In for Pricing
View Details