Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHGDH, Human (C-His)

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PHGDH Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phgdh-protein-human-c-his-solution.html

Purity

95.0

Smiles

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Molecular Formula

26227 (Gene_ID) O43175 (M1-F533) (Accession)

Molecular Weight

Approximately 57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EpCAM Antibody / Extracellular domain
V7228SAF-100UG 100 µg

EpCAM Antibody / Extracellular domain

Sign In for Pricing
View Details
Ldah (NM_001167768) Mouse Tagged Lenti ORF Clone
MR214866L4 10 µg

Ldah (NM_001167768) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
POMT2 Recombinant Protein (Mouse)
RP163466 100 µg

POMT2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)
MBS2090331-01 5x 96 Tests

Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)
MBS2090331-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)
MBS2090331-03 10x 96 Tests

Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details