Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHGDH, Human (C-His)

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PHGDH Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phgdh-protein-human-c-his-solution.html

Purity

95.0

Smiles

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Molecular Formula

26227 (Gene_ID) O43175 (M1-F533) (Accession)

Molecular Weight

Approximately 57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgD (Delta chain specific) rabbit polyclonal antibody, Purified
DP021-05 500 µL

Human IgD (Delta chain specific) rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
CDK7 (NM_001799) Human Recombinant Protein
TP302736M 100 µg

CDK7 (NM_001799) Human Recombinant Protein

Sign In for Pricing
View Details
DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)
245439-Biotin 100 µL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)

Sign In for Pricing
View Details
hsa-miR-4677-5p miRNA Inhibitor
MIH02529 2x 5.0 nmol

hsa-miR-4677-5p miRNA Inhibitor

Sign In for Pricing
View Details
MEIS2 Polyclonal Antibody
CAC13112-01 50 µg

MEIS2 Polyclonal Antibody

Sign In for Pricing
View Details
MEIS2 Polyclonal Antibody
CAC13112-02 100 µg

MEIS2 Polyclonal Antibody

Sign In for Pricing
View Details