Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHGDH, Human (C-His)

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PHGDH Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phgdh-protein-human-c-his-solution.html

Purity

95.0

Smiles

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Molecular Formula

26227 (Gene_ID) O43175 (M1-F533) (Accession)

Molecular Weight

Approximately 57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoptosis repressor with CARD (NOL3) Human qPCR Primer Pair (NM_003946)
HP207375 200 Reactions

Apoptosis repressor with CARD (NOL3) Human qPCR Primer Pair (NM_003946)

Sign In for Pricing
View Details
RRP1 Protein Vector (Rat) (pPM-C-His)
PV302629 500 ng

RRP1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Bromocyclopentane-d9
TRC-B682827-100MG 100 mg

Bromocyclopentane-d9

Sign In for Pricing
View Details
Mouse Monoclonal Mouse Pure-Blot anti-Rabbit IgG Secondary Antibody (eB182) [HRP]
NBP3-11668 200 µL

Mouse Monoclonal Mouse Pure-Blot anti-Rabbit IgG Secondary Antibody (eB182) [HRP]

Sign In for Pricing
View Details
Anti-RAD51 (Prognostic and Response to Chemotherapy Marker) Monoclonal Antibody (Clone: RAD51/2701)
36-3079-100 100 µg

Anti-RAD51 (Prognostic and Response to Chemotherapy Marker) Monoclonal Antibody (Clone: RAD51/2701)

Sign In for Pricing
View Details
Lentiviral human MAP1S sgRNA gene knockout kit - Lentiviral human MAP1S sgRNA gene knockout kit (25)
GTR15401547 1 Vial

Lentiviral human MAP1S sgRNA gene knockout kit - Lentiviral human MAP1S sgRNA gene knockout kit (25)

Sign In for Pricing
View Details