PHGDH, Human (C-His)
PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
PHGDH Protein, Human (C-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/phgdh-protein-human-c-his-solution.html
Purity
95.0
Smiles
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Molecular Formula
26227 (Gene_ID) O43175 (M1-F533) (Accession)
Molecular Weight
Approximately 57 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040043-100 1x 100 µL
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040270-100 1x 100 µL
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942298-500 1x 500 µL
Cytokeratin 8/18 (rKRT8.18/1346), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details