Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-like protein 11 (BCL2L11)

Product Specifications

Product Name Alternative

(Bcl2-L-11) (Bcl2-interacting mediator of cell death)

Abbreviation

Recombinant Human BCL2L11 protein

Gene Name

BCL2L11

UniProt

O43521

Expression Region

1-198aa

Organism

Homo sapiens (Human)

Target Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

References & Citations

"DNA sequence of the adenovirus type 41 hexon gene and predicted structure of the protein." Toogood C.I.A., Hay R.T. J. Gen. Virol. 69:2291-2301 (1988) [PubMed] [Europe PMC] [Abstract]

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sst sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4671402 1.0 µg DNA

Sst sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Ethyl 5-nitrobenzofuran-2-carboxylate
E7670-01 1 g

Ethyl 5-nitrobenzofuran-2-carboxylate

Sign In for Pricing
View Details
Ethyl 5-nitrobenzofuran-2-carboxylate
E7670-02 5 g

Ethyl 5-nitrobenzofuran-2-carboxylate

Sign In for Pricing
View Details
Epoxide hydrolase (EPHX1) Human shRNA Lentiviral Particle (Locus ID 2052)
TL313192V 500 µL Each

Epoxide hydrolase (EPHX1) Human shRNA Lentiviral Particle (Locus ID 2052)

Sign In for Pricing
View Details
Cog1 (NM_001107062) Rat Tagged ORF Clone Lentiviral Particle
RR207945L3V 200 µL

Cog1 (NM_001107062) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CHRNA9 (Cholinergic Receptor, Nicotinic, alpha 9, HSA243342, MGC142109, MGC142135, NACHRA9) (HRP)
MBS6183581-01 0.1 mL

CHRNA9 (Cholinergic Receptor, Nicotinic, alpha 9, HSA243342, MGC142109, MGC142135, NACHRA9) (HRP)

Sign In for Pricing
View Details