Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

Product Specifications

Product Name Alternative

S100A9 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human.html

Purity

97.99

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 14.0 kDa

References & Citations

[1]Simard JC, et al. Human S100A9 potentiates IL-8 production in response to GM-CSF or fMLP via activation of a different set of transcription factors in neutrophils. FEBS Lett. 2014 Jun 13;588 (13) :2141-6.|[2]Miyasaki KT, et al. In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena. J Dent Res. 1993 Feb;72 (2) :517-23.|[3]Fanò G, et al. The S-100: a protein family in search of a function. Prog Neurobiol. 1995 May;46 (1) :71-82. |[4]Vogl T, et al. MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes. Blood. 2004 Dec 15;104 (13) :4260-8.|[5]Viemann D, et al. Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells. Blood. 2005 Apr 1;105 (7) :2955-62.|[6]Nakatani Y, et al. Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity. Mediators Inflamm. 2005 Oct 24;2005 (5) :280-92.|[7]Björk P, et al. Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides. PLoS Biol. 2009 Apr 28;7 (4) :e97.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oligophrenin-1 shRNA Plasmid (m)
sc-36126-SH 20 µg

Oligophrenin-1 shRNA Plasmid (m)

Sign In for Pricing
View Details
KIF13A Protein Vector (Rat) (pPB-N-His)
PV276147 500 ng

KIF13A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-04 1 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details