What is the catalog number for S100A9, Human?

The catalog number for S100A9, Human is HY-P70532.

What sizes are available for S100A9, Human?

S100A9, Human is available in the following size(s): 5 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg, 1 mg.

How many pack sizes does S100A9, Human come in?

S100A9, Human is available in 7 different pack sizes.

Is S100A9, Human in stock?

S100A9, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures S100A9, Human?

S100A9, Human is manufactured by QuantiMol.

What is the estimated delivery time for S100A9, Human?

Estimated delivery time for S100A9, Human is approximately 15 business day(s), depending on your location.

S100A9, Human

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

Product Specifications

Product Name Alternative

S100A9 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human.html

Purity

97.99

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 14.0 kDa

References & Citations

[1]Simard JC, et al. Human S100A9 potentiates IL-8 production in response to GM-CSF or fMLP via activation of a different set of transcription factors in neutrophils. FEBS Lett. 2014 Jun 13;588 (13) :2141-6.|[2]Miyasaki KT, et al. In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena. J Dent Res. 1993 Feb;72 (2) :517-23.|[3]Fanò G, et al. The S-100: a protein family in search of a function. Prog Neurobiol. 1995 May;46 (1) :71-82. |[4]Vogl T, et al. MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes. Blood. 2004 Dec 15;104 (13) :4260-8.|[5]Viemann D, et al. Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells. Blood. 2005 Apr 1;105 (7) :2955-62.|[6]Nakatani Y, et al. Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity. Mediators Inflamm. 2005 Oct 24;2005 (5) :280-92.|[7]Björk P, et al. Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides. PLoS Biol. 2009 Apr 28;7 (4) :e97.