Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC3B, Human (HEK293, His)

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[1][2][3]. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LRRC3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrrc3b-protein-human-hek-293-his.html

Smiles

CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDY

Molecular Formula

116135 (Gene_ID) Q96PB8 (C34-Y204) (Accession)

Molecular Weight

Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL
BNC400674-500 1x 500 µL

Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF405S conjugate, 0.1mg/mL
BNC041777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details