Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2AX (H2AFX)

Product Specifications

Product Name Alternative

Histone H2A.X

Abbreviation

Recombinant Human H2AFX protein

Gene Name

H2AFX

UniProt

P16104

Expression Region

1-143aa

Organism

Homo sapiens (Human)

Target Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0391006 1.0 µg DNA

CCL27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Cysteinyl leukotriene receptor 2, CYSLTR2 ELISA KIT
ELI-33826h 96 Tests

Human Cysteinyl leukotriene receptor 2, CYSLTR2 ELISA KIT

Sign In for Pricing
View Details
OR4C17P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
63335111 3x 1.0 µg

OR4C17P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Malondialdehyde Antibody (6H6) [PE/Cy7]
NBP2-59366PECY7 0.1 mL

Mouse Monoclonal Malondialdehyde Antibody (6H6) [PE/Cy7]

Sign In for Pricing
View Details
Human Chorionic Gonadotropin/CGA ELISA Kit
SEKH-0617-01 48 Tests

Human Chorionic Gonadotropin/CGA ELISA Kit

Sign In for Pricing
View Details
Human Chorionic Gonadotropin/CGA ELISA Kit
SEKH-0617-02 96 Tests

Human Chorionic Gonadotropin/CGA ELISA Kit

Sign In for Pricing
View Details