Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Lipoprotein signal peptidase (lspA) (I65V)

Product Specifications

CAS Number

9000-83-3

Gene Name

lspA

UniProt

Q9CGU5

Expression Region

1-150aa (I65V)

Organism

Lactococcus lactis

Target Sequence

MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK

Tag

C-terminal 6xHis-tagged

Source

in vitro E.coli expression system

Field of Research

Others

Assay Type

CF Transmembrane Protein & Developed Protein

Relevance

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF640R conjugate, 0.1mg/mL
BNC400749-500 1x 500 µL

CD8 (C8/144B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF640R conjugate, 0.1mg/mL
BNC400644-100 1x 100 µL

TGFalpha (MF9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF594 conjugate, 0.1mg/mL
BNC941227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
BNC680698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details