Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 10 (FGF10) (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 10; FGF-10; Keratinocyte growth factor 2; FGF10; KGF-2; KGF2

Abbreviation

Recombinant Human FGF10 protein (Active)

Gene Name

FGF10

UniProt

O15520

Expression Region

38-208aa

Organism

Homo sapiens (Human)

Target Sequence

QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cell proliferation assay using Mv.1.Lu Mink lung epithelial cells. The ED50 for this effect is ≤10 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBF4 Human shRNA Plasmid Kit (Locus ID 57593)
TL321157 1 Kit

EBF4 Human shRNA Plasmid Kit (Locus ID 57593)

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida truC Protein (aa 1-243)
VAng-Cr7426-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida truC Protein (aa 1-243)

Sign In for Pricing
View Details
Anti-Hsp27/Hspb1 Antibody Picoband®, PE Conjugate
A00676-PE 100 µg/Vial

Anti-Hsp27/Hspb1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal UbcH5a/UBE2D1 Antibody (07) [PerCP]
NBP3-06652PCP 0.1 mL

Mouse Monoclonal UbcH5a/UBE2D1 Antibody (07) [PerCP]

Sign In for Pricing
View Details
ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, RING Finger Protein 141, RNF141, ZFP26) (Azide Free) (MaxLight 405)
MBS6188496-01 0.1 mL

ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, RING Finger Protein 141, RNF141, ZFP26) (Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, RING Finger Protein 141, RNF141, ZFP26) (Azide Free) (MaxLight 405)
MBS6188496-02 5x 0.1 mL

ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, RING Finger Protein 141, RNF141, ZFP26) (Azide Free) (MaxLight 405)

Sign In for Pricing
View Details