Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-16, Mouse (His)

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse (His) is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-16 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-16-protein-mouse-his.html

Purity

98.0

Smiles

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Molecular Formula

16170 (Gene_ID) O54824 (S1205-S1322) (Accession)

Molecular Weight

14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR Antibody
orb1461438-01 20 µg

CFTR Antibody

Sign In for Pricing
View Details
CFTR Antibody
orb1461438-02 100 µg

CFTR Antibody

Sign In for Pricing
View Details
pcDNA3.1-HA-Ubiquitin Plasmid
PVTB00017-2e 2 µg

pcDNA3.1-HA-Ubiquitin Plasmid

Sign In for Pricing
View Details
CREB Regulated Transcription Coactivator 1 (CRTC1) BioAssayTM ELISA Kit (Mouse)
589166 96 Tests

CREB Regulated Transcription Coactivator 1 (CRTC1) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
CYCSP45 sgRNA CRISPR Lentivector (Human) (Target 2)
K0547303 1.0 µg DNA

CYCSP45 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Olr20 Protein Vector (Rat) (pPB-C-His)
PV289282 500 ng

Olr20 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details