IFN-beta, Human (CHO)

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS) . IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. IFN-beta Protein, Human (CHO) is a recombinant interferon-beta protein (CHO), expressed by CHO, without a tag.

Product Specifications

Product Name Alternative

IFN-beta Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-beta-protein-human-cho.html

Purity

98.0

Smiles

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Formula

3456 (Gene_ID) P01574 (M22-N187) (Accession)

Molecular Weight

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Jeannin S, et al. Response to interferon-Beta treatment in afro-caribbeans with multiple sclerosis. Mult Scler Int. 2011;2011:950126.|[2]Stübgen JP. Recombinant interferon-beta therapy and neuromuscular disorders. J Neuroimmunol. 2009 Jul 25;212 (1-2) :132-41.|[3]Abraham A K, et al. Mechanisms of interferon-β effects on bone homeostasis. Biochemical pharmacology, 2009, 77 (12) : 1757-1762.|[4]Yeung VP, et al. Elimination of an immunodominant CD4+ T cell epitope in human IFN-beta does not result in an in vivo response directed at the subdominant epitope. J Immunol. 2004 Jun 1;172 (11) :6658-65.|[5]Singh R, et al. Cell density-dependent modulation of basic fibroblast growth factor expression by human interferon-beta. Int J Oncol. 1996 Apr;8 (4) :649-56.|[6]Fraser-Smith EB, et al. Enhanced efficacy of the acyclic nucleoside 9- (1,3-dihydroxy-2-propoxymethyl) guanine in combination with beta-interferon against herpes simplex virus type 2 in mice. Antimicrob Agents Chemother. 1984 May;25 (5) :563-5.|[7]Zhang LN, et al. Interferon-beta attenuates angiotensin II-accelerated atherosclerosis and vascular remodeling in apolipoprotein E deficient mice. Atherosclerosis. 2008 Mar;197 (1) :204-11. |[8]Karpusas M, et al. The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94 (22) :11813-8.