Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae serotype 4 ribosomal protein S12 (rpsL)

Product Specifications

Abbreviation

Recombinant Streptococcus pneumoniae serotype 4 rpsL protein

Gene Name

RpsL

UniProt

P0A4A7

Expression Region

1-137aa

Organism

Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

Target Sequence

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

With S4 and S5 plays an important role in translational accuracy. ; Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

References & Citations

"Complete genome sequence of a virulent isolate of Streptococcus pneumoniae." Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.N., Heidelberg J.F., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.L., Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O., Salzberg S.L. Fraser C.M. Science 293:498-506 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-01 0.05 mg (E-Coli)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details
Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-02 0.05 mg (Yeast)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details
Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-03 0.2 mg (E-Coli)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details
Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-04 0.05 mg (Baculovirus)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details
Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-05 0.5 mg (E-Coli)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details
Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)
MBS1425694-06 0.2 mg (Yeast)

Recombinant Candida glabrata Pre-mRNA-splicing factor CWC26 (CWC26)

Ask
View Details